Dayot Upamecano Fifa 21, Kultusministerium Bw Sturm, Offenes Mrt Berlin Charlottenburg, Corona-pandemie Home Office, Schulen Mv Corona Geschlossen, Bezirk Oberbayern Kantine, Instagram Passwort Und Email Vergessen, Ich Habe Ein Anliegen, Seilrutsche Elbauenpark Preise, Home-office Beantragen Vorlage, Microsoft Q2 2020, Zahnambulatorium Feldkirch Vgkk, To Make In Present Perfect, " /> Dayot Upamecano Fifa 21, Kultusministerium Bw Sturm, Offenes Mrt Berlin Charlottenburg, Corona-pandemie Home Office, Schulen Mv Corona Geschlossen, Bezirk Oberbayern Kantine, Instagram Passwort Und Email Vergessen, Ich Habe Ein Anliegen, Seilrutsche Elbauenpark Preise, Home-office Beantragen Vorlage, Microsoft Q2 2020, Zahnambulatorium Feldkirch Vgkk, To Make In Present Perfect, " />

fritzbox 6591 hack

fritzbox 6591 hack

] watching = false; } "initiatorBinding" : true, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "revokeMode" : "true", })(LITHIUM.jQuery); ] "context" : "", LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { ] "context" : "envParam:quiltName,message", "action" : "rerender" } else { "disableKudosForAnonUser" : "false", { "event" : "approveMessage", "actions" : [ ] "action" : "rerender" } $(this).next().toggle(); "action" : "rerender" } "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "includeRepliesModerationState" : "false", ], "actions" : [ { }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'FFplaGFmWJEkn3UsRfNSP_ARzm2m7yM1zLMD2z_ZBFI. "initiatorDataMatcher" : "data-lia-kudos-id" { "context" : "envParam:quiltName", "action" : "pulsate" ;(function($) { "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); ] "initiatorBinding" : true, "disallowZeroCount" : "false", "actions" : [ "useTruncatedSubject" : "true", { "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "actions" : [ }, "action" : "rerender" ] "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_77a9f4e33a8f2c', 'disableAutoComplete', '#ajaxfeedback_77a9f4e231937f_0', 'LITHIUM:ajaxError', {}, 'pTJfA0maQnKqzKZRhuQJZoCJoVI4otttOmnr5GGOVbY. "useCountToKudo" : "false", }); LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); ] { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); }, LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); } "context" : "envParam:quiltName", "useTruncatedSubject" : "true", { }, "event" : "expandMessage", // just for convenience, you need a login anyways... "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); { "context" : "envParam:entity", resetMenu(); }, LITHIUM.Dialog({ "action" : "rerender" "action" : "rerender" "event" : "kudoEntity", } ] $('.community-menu').removeClass('active') }, { "actions" : [ { ] } } "action" : "rerender" { "actions" : [ { o.innerHTML = "Page must be an integer number. }, "messageViewOptions" : "1111110111111111111110111110100101001101" } "actions" : [ "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { } { { LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "MessagesWidgetEditCommentForm", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "activecastFullscreen" : false, "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", if ( neededkeys[count] == key ) { } }, "actions" : [ // If watching, pay attention to key presses, looking for right sequence. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useSubjectIcons" : "true", "action" : "rerender" } } { "context" : "", "action" : "pulsate" "useSubjectIcons" : "true", { "context" : "", "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/157039","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-WWoRaCxn977i3STI4mkRtkE3Q6b2pVgS1gJaNXFzhY. ] "useTruncatedSubject" : "true", "actions" : [ "actions" : [ "action" : "rerender" "event" : "addThreadUserEmailSubscription", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "context" : "", "actions" : [ "parameters" : { } }, { "context" : "envParam:entity", } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233348}); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "quiltName" : "ForumMessage", { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'Pi14PUqRqaWIvnHFOEKWDpy-t9Z3TCIveQ5bMKIyYxM. ] LITHIUM.Dialog.options['-1040003818'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "quiltName" : "ForumMessage", "selector" : "#kudosButtonV2_7", } ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" "actions" : [ { "buttonDialogCloseAlt" : "Schließen", "event" : "addThreadUserEmailSubscription", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", AVM hat kürzlich die neue FritzBox für den Kabelanschluss vorgestellt: Die FRITZ!Box 6591 Cable ist deren bislang schnellster Router und gleichzeitig AVMs erster für den neuen DOCSIS-3.1-Standard. LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // Reset the conditions so that someone can do it all again. { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "message" : "2415689", { } "initiatorBinding" : true, "useSimpleView" : "false", $(event.data.selector).addClass('cssmenu-open') "action" : "rerender" "context" : "lia-deleted-state", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); }, } { "includeRepliesModerationState" : "false", } "accessibility" : false, ] "action" : "rerender" "context" : "envParam:entity", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "context" : "lia-deleted-state", ', 'ajax'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport.ComponentEvents.set({ { "triggerEvent" : "click", } }, }, "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { }, { "event" : "addThreadUserEmailSubscription", "entity" : "2415822", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "actions" : [ "actions" : [ { "event" : "MessagesWidgetAnswerForm", "useCountToKudo" : "false", "action" : "rerender" "context" : "envParam:quiltName,message", "parameters" : { "disallowZeroCount" : "false", { "; "context" : "lia-deleted-state", "context" : "lia-deleted-state", { } "actions" : [ ] "event" : "removeMessageUserEmailSubscription", "actions" : [ } }, } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/157039","ajaxErrorEventName":"LITHIUM:ajaxError","token":"aE6aXqtJC4HGZcU9F5nQ_LiuBmM1AcjLt9u5KrNEw1k. } ] }, ] "actions" : [ "useCountToKudo" : "false", }, "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "addMessageUserEmailSubscription", "actions" : [ LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); logmein: [76, 79, 71, 77, 69, 73, 78], "truncateBodyRetainsHtml" : "false", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,message", o.innerHTML = "Page must be an integer number. "event" : "ProductMessageEdit", "actions" : [ }, "event" : "MessagesWidgetEditCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" "initiatorBinding" : true, { }); setWarning(pagerId); ] "event" : "ProductAnswer", "event" : "ProductAnswerComment", })(LITHIUM.jQuery); ], "event" : "kudoEntity", { "context" : "", "action" : "rerender" { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_7","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413741}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2420348}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413747}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413748}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413772}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413774}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413788}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413795}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2413822}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2415689}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2415822}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540369}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563041}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2563040}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2562001}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565822}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565716}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565656}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565579}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565489}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565367}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565315}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565244}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565157}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565110}}]); "selector" : "#messageview_1", "truncateBodyRetainsHtml" : "false", { ] "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName", "action" : "rerender" "eventActions" : [ } { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $(document).keydown(function(e) { ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,expandedQuiltName", { { { "actions" : [ "context" : "envParam:feedbackData", "forceSearchRequestParameterForBlurbBuilder" : "false", $(document).ready(function(){ "actions" : [ } ] "context" : "", }, LITHIUM.Dialog.options['1330283185'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "context" : "envParam:quiltName,product,contextId,contextUrl", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } { "selector" : "#kudosButtonV2_8", Leider muss ich den Router oft neu starten, weil er rumspackt. }, ] "context" : "", { "}); }, }, { { { } "useTruncatedSubject" : "true", "eventActions" : [ "disableKudosForAnonUser" : "false", { "actions" : [ ] } // console.log('watching: ' + key); "truncateBodyRetainsHtml" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "selector" : "#messageview_9", { "event" : "removeThreadUserEmailSubscription", }, } "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ] }, "disableLinks" : "false", "truncateBody" : "true", "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "actions" : [ "includeRepliesModerationState" : "false", { "action" : "rerender" }, ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2413772 .lia-rating-control-passive', '#form_3'); "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2415822 .lia-rating-control-passive', '#form_9'); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "event" : "RevokeSolutionAction", "action" : "pulsate" "parameters" : { "action" : "addClassName" "triggerEvent" : "click", "message" : "2413748", ] } return false; }, $(event.data.selector).removeClass('cssmenu-open'); ] "initiatorDataMatcher" : "data-lia-message-uid" } "context" : "", { "context" : "envParam:entity", "event" : "expandMessage", "event" : "ProductAnswerComment", } { "action" : "rerender" LITHIUM.Dialog.options['-150559959'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ', 'ajax'); }, LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { "initiatorBinding" : true, "actions" : [ } ] "context" : "", } setWarning(pagerId); { "linkDisabled" : "false" }, }, "action" : "rerender" ] "event" : "markAsSpamWithoutRedirect", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. watching = true; "action" : "rerender" { "useCountToKudo" : "false", { "accessibility" : false, //$('#vodafone-community-header').css('display','block'); "event" : "expandMessage", "action" : "rerender" "event" : "addThreadUserEmailSubscription", watching = false; "action" : "addClassName" "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "componentId" : "kudos.widget.button", }, ] "event" : "removeThreadUserEmailSubscription", }); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "RevokeSolutionAction", { "eventActions" : [ "context" : "", "context" : "", } "actions" : [ } }, { } "action" : "rerender" "useTruncatedSubject" : "true", { "event" : "ProductAnswerComment", "event" : "approveMessage", ] "defaultAriaLabel" : "", var key = e.keyCode; ] "context" : "", }, "event" : "MessagesWidgetEditCommentForm", Bist du sicher, dass du fortfahren möchtest? LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", return; "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-kudos-id" { o.innerHTML = "Page must be an integer number. ] "parameters" : { { "actions" : [ if ( key == neededkeys[0] ) { "entity" : "2413788", { } "action" : "pulsate" "actions" : [ }, ] "actions" : [ { "disableLabelLinks" : "false", ] } { ] ] }, "linkDisabled" : "false" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); ] { "useCountToKudo" : "false", "action" : "rerender" ;(function($) { "action" : "rerender" ] "disableLinks" : "false", "actions" : [ } ] "action" : "addClassName" ] ;(function($) { ] "event" : "addMessageUserEmailSubscription", { { "actions" : [ { ] "event" : "RevokeSolutionAction", ] "event" : "ProductAnswer", LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "componentId" : "kudos.widget.button", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "addClassName" { "context" : "", ] "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } }, "revokeMode" : "true", }, { LITHIUM.Loader.runJsAttached(); { ] { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'Pi14PUqRqaWIvnHFOEKWDpy-t9Z3TCIveQ5bMKIyYxM. { $(document).ready(function(){ { "truncateBody" : "true", { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" } "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2413822,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ] "initiatorBinding" : true, "action" : "pulsate" "actions" : [ } ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } ] "action" : "rerender" "event" : "ProductMessageEdit", }, // We're good so far. "disableLinks" : "false", "quiltName" : "ForumMessage", "context" : "envParam:feedbackData", }); "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "forums.widget.message-view", "initiatorDataMatcher" : "data-lia-message-uid" }, "event" : "ProductMessageEdit", "context" : "", }, }, "event" : "expandMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }, }); "forceSearchRequestParameterForBlurbBuilder" : "false",

Dayot Upamecano Fifa 21, Kultusministerium Bw Sturm, Offenes Mrt Berlin Charlottenburg, Corona-pandemie Home Office, Schulen Mv Corona Geschlossen, Bezirk Oberbayern Kantine, Instagram Passwort Und Email Vergessen, Ich Habe Ein Anliegen, Seilrutsche Elbauenpark Preise, Home-office Beantragen Vorlage, Microsoft Q2 2020, Zahnambulatorium Feldkirch Vgkk, To Make In Present Perfect,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.